|
Product Details:
|
Name: | FOXO4-DRI | CAS No.: | N/A |
---|---|---|---|
Storage: | -9°C | Appearance: | Powder |
MOQ: | 50mg | Shelf Life: | 1 Year. |
Purity: | 95% Min | ||
High Light: | 50mg 95% FOXO4 DRI Peptide,Peptide Powders Vials Packaging,95% Min Purity Peptide Powders |
FOXO4 D-Retro-Inverso peptide 95% FOXO4-DRI 98% Senolytics raw powder and lyophilized powder in vials
supply both raw powder and lyophilized powder in vials.
Lead time of raw powder is 1 week after paid, lyophilized powder need to wait for 2 weeks after paid.
Sequence: H-D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D-Gln-D-Ser-D-Ile-D-Leu-D-Glu-D-Ala-D-Tyr-D-Ser-D-Gln-D-Asn-D-Gly-D-Trp-D-Ala-D-Asn-D-Arg-D-Arg-D-Ser-D-Gly-D-Gly-D-Lys-D-Arg-D-Pro-D-Pro-D-Pro-D-Arg-D-Arg-D-Arg-D-Gln-D-Arg-D-Arg-D-Lys-D-Lys-D-Arg-D-Gly-OH
Storage
FOXO4 D-Retro-Inverso(DRI) should be stored in a freezer at or below -9C.
After reconstitution, FOXO4 D-Retro-Inverso(DRI) peptide should be kept refrigerated.
Product introduction
Foxo4-dri, FOXO4 D-Retro-Inverso peptide, also known as Proxofim, was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.
FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.
How to order from Senwayer
1. Send inquiry to let us know the product and quantity you need
2. Senwayer Team will provide with quotation
3. Make full payment then Senwayer Team will start to arrange shipment. (Bank transfer, Bitcoin, USDT)
4. Tracking number usually can be provided in 5 working days after payment received.
5. Parcel will arrive you safely.
We speicalize in:
steroid hormone powder
hgh,hcg
all bodybuilding peptide (GHRP,Ipamorelin, BPC157,Cjc1295)
steroid 10ml injection oils, oral pills
SARMs powder
nootropics powder
mainly API
You're welcome to contact me via:
Email: kate.senwayer@senwayer.com
Whatsapp:+86-16607120890
Wickr me:katezhang
Wechat:+86-16607120890
Telegram:+86-16607120890
Contact Person: Mrs. Angie Zhang
Tel: +8613627115097
Fax: 86-27-5970-7018