Home ProductsCosmetic Peptide

95% Min Purity FOXO4 DRI Peptide Powders Vials Packaging

Certification
China Wuhan Senwayer Century Chemical Co., Ltd. certification
China Wuhan Senwayer Century Chemical Co., Ltd. certification
Customer Reviews
everything was great. friendly and understanding representative and fast shipping(compared to other items on here). my shoulder feels much stronger and healthier after only one and a half weeks.

—— Terry Smith

Superb Excellence is all I can say about this Company and its products. I will continue to buy from this company. The service is excellent and the product matches the service. Thanks for the great product and service. I will be ordering from you really soon.

—— Brant huges

Love it I’ve been using it for a long time

—— Drew

I'm Online Chat Now

95% Min Purity FOXO4 DRI Peptide Powders Vials Packaging

95% Min Purity FOXO4 DRI Peptide Powders Vials Packaging
95% Min Purity FOXO4 DRI Peptide Powders Vials Packaging 95% Min Purity FOXO4 DRI Peptide Powders Vials Packaging 95% Min Purity FOXO4 DRI Peptide Powders Vials Packaging

Large Image :  95% Min Purity FOXO4 DRI Peptide Powders Vials Packaging

Product Details:
Place of Origin: China
Brand Name: Senwayer
Certification: GMP/ISO
Model Number: FOXO4-DRI
Payment & Shipping Terms:
Minimum Order Quantity: 50mg
Price: To be negotiated
Packaging Details: vials
Delivery Time: At least 10 working days
Payment Terms: T/T , bank transfer , Bitcoin , USDT
Supply Ability: 5g per month

95% Min Purity FOXO4 DRI Peptide Powders Vials Packaging

Description
Name: FOXO4-DRI CAS No.: N/A
Storage: -9°C Appearance: Powder
MOQ: 50mg Shelf Life: 1 Year.
Purity: 95% Min
High Light:

50mg 95% FOXO4 DRI Peptide

,

Peptide Powders Vials Packaging

,

95% Min Purity Peptide Powders

 

FOXO4 D-Retro-Inverso peptide 95% FOXO4-DRI 98% Senolytics raw powder and lyophilized powder in vials

 

supply both raw powder and lyophilized powder in vials. 

Lead time of raw powder is 1 week after paid,  lyophilized powder need to wait for 2 weeks after paid.

 

Sequence: H-D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D-Gln-D-Ser-D-Ile-D-Leu-D-Glu-D-Ala-D-Tyr-D-Ser-D-Gln-D-Asn-D-Gly-D-Trp-D-Ala-D-Asn-D-Arg-D-Arg-D-Ser-D-Gly-D-Gly-D-Lys-D-Arg-D-Pro-D-Pro-D-Pro-D-Arg-D-Arg-D-Arg-D-Gln-D-Arg-D-Arg-D-Lys-D-Lys-D-Arg-D-Gly-OH

 

 

Storage

FOXO4 D-Retro-Inverso(DRI) should be stored in a freezer at or below -9C.

After reconstitution, FOXO4 D-Retro-Inverso(DRI) peptide should be kept refrigerated.

 

 

Product introduction

Foxo4-dri, FOXO4 D-Retro-Inverso peptide, also known as Proxofim, was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

 

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

 

 

How to order from Senwayer

1. Send inquiry to let us know the product and quantity you need

2. Senwayer Team will provide with quotation

3. Make full payment then Senwayer Team will start to arrange shipment. (Bank transfer, Bitcoin, USDT)

4. Tracking number usually can be provided in 5 working days after payment received.

5. Parcel will arrive you safely.

 

 

We speicalize in:

steroid hormone powder

hgh,hcg

all bodybuilding peptide (GHRP,Ipamorelin, BPC157,Cjc1295)

steroid 10ml injection oils, oral pills

SARMs powder

nootropics powder

mainly API

 

You're welcome to contact me via:

Email: kate.senwayer@senwayer.com
Whatsapp:+86-16607120890
Wickr me:katezhang
Wechat:+86-16607120890
Telegram:+86-16607120890

 

95% Min Purity FOXO4 DRI Peptide Powders Vials Packaging 095% Min Purity FOXO4 DRI Peptide Powders Vials Packaging 1


 

95% Min Purity FOXO4 DRI Peptide Powders Vials Packaging 295% Min Purity FOXO4 DRI Peptide Powders Vials Packaging 3

95% Min Purity FOXO4 DRI Peptide Powders Vials Packaging 4

 

 

Contact Details
Wuhan Senwayer Century Chemical Co., Ltd.

Contact Person: kate

Tel: +8616607120890

Send your inquiry directly to us (0 / 3000)